PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05219.1_g00002.1
Common NameRsLFY2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LFY
Protein Properties Length: 105aa    MW: 11799.4 Da    PI: 8.3863
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05219.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY190.11.7e-58185302386
                  FLO_LFY 302 mrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                              mrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Rsa1.0_05219.1_g00002.1   1 MRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAA 85 
                              9*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.3E-58185IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MRHYVHCYAL HCLDEEASNA LRRAFKERGE NVGSWRQACY KPLVDIACRH GWDIDAVFNA  60
HPRLSIWYVP TKLRQLCHLE RNNAAAALVG GISCEGSSAS GRFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A4e-66110480186PROTEIN LEAFY
2vy2_A4e-66110480186PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4492491e-156AB449249.1 Raphanus sativus RsLFY2 mRNA for leafy-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627202.11e-69PREDICTED: putative transcription factor BOFH isoform X2
SwissprotQ009582e-65LFY_ARATH; Protein LEAFY
TrEMBLB7XD701e-71B7XD70_RAPSA; Leafy-like protein
STRINGBra019619.1-P8e-67(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-66floral meristem identity control protein LEAFY (LFY)